CST3 Protein

10157

Size：100 μl Price：$ 239 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

CST3 Protein [100 µg]

Cat. #: 10157

Product Name: CST3 Protein

Synonyms: Cystatin C, Cystatin 3, CYSC

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 16 kDa

Purity: >95% by SDS-PAGE

Introduction: Cystatin C, which belongs to the type 2 cystatin gene family, is a potent inhibitor of lysosomal proteinases. It regulates the activity of cathepsin S, a protease with central regulatory functions in retinal pigment epithelial (RPE) cells.

Amino Acid Sequence (1-146)

MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDM YHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQG TMTLSKSTCQDA

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged CST3 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References: 1. Paraoan, L. et al., Traffic 5: 884-895, 2004. 2. Ratnayaka, A. et al., Exp. Eye Res. 84: 1135-1139, 2007. 3. Zurdel, J. et al., Brit. J. Ophthal. 86: 214-219, 2002.

Reference citations

No data available

Product Targets

Product Categories

CST3 Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us