Arl3 Protein

10152

Size：100 μl Price：$ 239 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Arl3 Protein
[100 µg]

Cat. #: 10152

Product Name: Arl3 Protein

Synonyms: ADP-ribosylation factor-like 3, ARFL3

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 20 kDa

Purity: >95% by SDS-PAGE

Introduction: Arl3 belongs to the member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases. Arl3 is also a member of the ADP-ribosylation factor family of GTP-binding proteins. Arl3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.

Amino Acid Sequence (1-182)

MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWD
IGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAA
PASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl3 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References:
1. Cavenagh, M. M. et al., J. Biol. Chem. 269: 18937-18942, 1994.
2. Grayson, C. et al., Hum. Molec. Genet. 11: 3065-3074, 2002.
3. Kim, H.-S. Cytogenet. Cell Genet. 83: 246-only, 1998.
4. Schrick, J. JAm. J. Path. 168: 1288-1298, 2006.
5. Veltel, S. et al., Nature Struct. Molec. Biol. 15: 373-380, 2008.

Reference citations

No data available

Product Targets

Product Categories

Arl3 Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us