Gαi2(Q205L) Protein

10147

Size：10 μl Price：$ 347 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Gα_i2(Q205L) Protein

Cat. #: 10147

Product Name: Gα_i2 Protein Q205L mutant

Synonyms: Guanine nucleotide binding protein, alpha inhibiting activity polypeptide 2, GNAI2, Galphai2

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 40 kDa

Purity: >95% by SDS-PAGE

Introduction: Heterotrimeric G proteins are critical cellular signal transducers. Gα_i represents one sub-family of G proteins that could mediate the inhibition of adenylyl cyclases. Other biochemical and physiological functions of Gα_i proteins are being explored.

Amino Acid Sequence (1-355, Q205L)

MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECR
QYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWAD
HGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGG
LRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDL FEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVI IKNNLKDCGLF

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Gα_i2 Q205L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.

References:
1. Blatt, C. et al., Proc. Nat. Acad. Sci. 85: 7642-7646, 1988.
2. Bloch, D. B. et al., Am. J. Hum. Genet. 42: 884-888, 1988.
3. Bray, P. et al., Proc. Nat. Acad. Sci. 84: 5115-5119, 1987.
4. Itoh, H. et al., J. Biol. Chem. 263: 6656-6664, 1988.
5. Lan, K.-L. et al., J. Biol. Chem. 273: 12794-12797, 1998.
6. Neer, E. J. et al., Hum. Genet. 77: 259-262, 1987.
7. Ogden, S. K. et al., Nature 456: 967-970, 2008.

Reference citations

No data available

Product Targets

Product Categories

Gαi2(Q205L) Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us