Rab7(Q67L) Protein

10135

Size：25 μl Price：$ 248 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Rab7(Q67L) Mutant

Cat. #: 10135

Product Name: Rab7 Protein Q67L mutant

Synonyms: Member RAS oncogene family, Rab7a, MGC102153

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 23 kDa

Purity: >95% by SDS-PAGE

Introduction: Members of the Rab family of Ras-related GTP-binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. Rab7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.

Amino Acid Sequence (1-207, Q67L)

MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGL
ERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQV
ATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAES
CSC

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab7 Q67L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.

References:
1. Edinger, A. L. et al., Dev. Cell 5: 571-582, 2003. 2. Houlden, H. et al., Ann. Neurol. 56: 586-590, 2004.
3. Meggouh, F. et al., Neurology 67: 1476-1478, 2006.
4. Rak, A. et al., Cell 117: 749-760, 2004.
5. Verhoeven, K. et al., Am. J. Hum. Genet. 72: 722-727, 2003.

Reference citations

No data available

Product Targets

Product Categories

Rab7(Q67L) Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us