Rab4A(Q67L) Protein

10131

Size：25 μl Price：$ 248 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Rab4A(Q67L) Mutant

Cat. #: 10131

Product Name: Rab4A Protein Q67L mutant

Synonyms: Member RAS oncogene family, RAB4, HRES-1/RAB4

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 24 kDa

Purity: >95% by SDS-PAGE

Introduction: The Rab family of Ras-related GTP-binding protein Rab4 is involved in bidirectional sarcolemmal-vesicular Adrb2 trafficking, which occurs continuously in healthy hearts and is necessary for normal baseline adrenergic responsiveness and resensitization after catecholamine exposure.

Amino Acid Sequence (1-213, Q67L)

MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGL
ERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFL
EASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRA
QAPNAQECGC

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab4A Q67L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.

References:
1. Barbosa, M. D. F. S. et al., Genomics 30: 439-444, 1995.
2. Odley, A. et al., Proc. Nat. Acad. Sci. 101: 7082-7087, 2004.
3. Rousseau-Merck, M.-F. et al., Hum. Genet. 86: 350-354, 1991.
4. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989.

Reference citations

No data available

Product Targets

Product Categories

Rab4A(Q67L) Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us