Arf6 Protein

10124

Size：100 μl Price：$ 239 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Arf6 Protein

Cat. #: 10124

Product Name: Arf6 Protein

Synonyms: ADP-ribosylation factor 6

Source: Human recombinant, His6-tag

Expression Host Species: E. coli

Molecular Weight: 17 kDa

Purity: >95% by SDS-PAGE

Introduction: Arf6 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf6 regulates membrane trafficking and the actin cytoskeketon at the plasma membrane and functions as a regulatory molecule of phagocytosis.

Amino Acid Sequence (13-175)

EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYT
GTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRD
RNWYVQPSCATSGDGLYEGLTWLTSNYKS

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arf6 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References:
1. Cavenagh, M. M. et al., J. Biol. Chem. 271: 21767-21774, 1996.
2. D'Souza-Schorey, C. et al., Science 267: 1175-1178, 1995.
3. Falace, A. et al., Am. J. Hum. Genet. 87: 365-370, 2010.
4. Hernandez-Deviez, D. J. et al., Nature Neurosci. 5: 623-624, 2002.
5. O'Neal, C. J. et al., Science 309: 1093-1096, 2005.

Reference citations

No data available

Product Targets

Product Categories

Arf6 Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us