Arf1(Δ17) Protein

10122

Size：10 μl Price：$ 347 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Arf1(Δ17) Protein

Cat. #: 10122

Product Name: Arf1 Protein Δ17 mutant

Synonyms: ADP-ribosylation factor 1

Source: Human, recombinant, His6-tag

Expression Host Species: E. coli

Molecular Weight: 21 kDa

Purity: >95% by SDS-PAGE

Introduction: Arf1 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport.

Amino Acid Sequence (1-181, Δ17)

MGNIFANLFKGLFGKK-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAM NAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.

References: 1. Amor, J. C. et al., Nature 372: 704-708, 1994. 2. Bobak, D. A. et al., Proc. Nat. Acad. Sci. 86: 6101-6105, 1989. 3. Hirai, M. et al., Genomics 34: 263-265, 1996. 4. Kumari, S. et al., Cell Biol. 10: 30-41, 2008. 5. Lee, C.-M. et al., J. Biol. Chem. 267: 9028-9034, 1992. 6. Mossessova, E. et al., Cell 92: 415-423, 1998. 7. Peng, Z. G. et al., Biofactors 2: 45-49, 1989. 8. Presley, J. F. et al., Nature 417: 187-193, 2002. 9. Renault, L. et al., Nature 426: 525-530, 2003.

Reference citations

No data available

Product Targets

Product Categories

Arf1(Δ17) Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us