NFE2L2(V32T) Protein

10452

Size：100 μl Price：$ 347 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

NFE2L2(V32T) Mutant

Cat. #: 10452

Product Name: NFE2L2 Protein V32T mutant

Synonyms: Nuclear factor (erythroid-derived 2)-like 2, Nrf2

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 26 kDa

Purity: >99% by SDS-PAGE

Introduction: NFE2L2 protein is encoded by NFE2L2 gene. It is a basic leucine zipper protein that regulates the expression of antioxidant proteins that protect against oxidative damage triggered by injury and inflammation. Several drugs that stimulate the NFE2L2 pathway are being studied for treatment of diseases that are caused by oxidative stress.

Amino Acid Sequence (1-170)

MMDLELPPPGLPSQQDMDLIDILWRQDIDLGTSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDAL
YFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing.

The purity of His-tagged NFE2L2 V32T was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.
References:
1. Moi P et al., Proc. Natl. Acad. Sci. U.S.A. 91 (21): 9926-30.
2. Gold R et al., N. Engl. J. Med. 367 (12): 1098-107.

Reference citations

No data available

Product Targets

Product Categories

NFE2L2(V32T) Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us