Email Us:info@neweastbio.com
Call Us:(+1) 610-945-2007
Size:100 μl Price:$ 347 Brand:NewEast Place of Origin:USA Immunogen:
NFE2L2(R34Q) Mutant
Cat. #: 10447 |
Product Name: NFE2L2 Protein R34Q mutant |
Synonyms: Nuclear factor (erythroid-derived 2)-like 2, Nrf2 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 26 kDa |
Purity: >99% by SDS-PAGE |
Introduction: NFE2L2 protein is encoded by NFE2L2 gene. It is a basic leucine zipper protein that regulates the expression of antioxidant proteins that protect against oxidative damage triggered by injury and inflammation. Several drugs that stimulate the NFE2L2 pathway are being studied for treatment of diseases that are caused by oxidative stress. |
Amino Acid Sequence (1-170) |
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSQEVFD FSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQL DEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDAL YFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIE SPVFIATNQAQSPETSVA |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing.The purity of His-tagged NFE2L2 R34Q was determined by SDS-PAGE and Coomassie Brilliant Blue Staining. |
References:
1. Moi P et al., Proc. Natl. Acad. Sci. U.S.A. 91 (21): 9926-30.
2. Gold R et al., N. Engl. J. Med. 367 (12): 1098-107.
Select By Alphabet
A B C D E F G H I J K L M N O P Q R S T U V W X Y ZSubscribe to our latest email
(+1) 610-945-2007 info@neweastbio.com sale@neweastbio.com 840 First Avenue, Suite 400, King of Prussia, PA 19406
Copyright © 2010 - 2024 NewEast Biosciences | All rights reserved
Bioactive Transmembrane Proteins Antibodies for Transmembrane Proteins G Protein | GTPase