Rap1B Protein

10120

Size：100 μl Price：$ 347 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Rap1B Protein

Cat. #: 10120

Product Name: Rap1B Protein

Synonyms: Member of RAS oncogene family, K-REV, RAL1B

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 21 kDa

Purity: >95% by SDS-PAGE

Introduction: Small GTPases are a super-family of cellular signaling regulators. Rap family members (Rap1A, Rap1B, Rap2A, Rap2B, and Rap2C) are Ras-like GTPases that regulate cell proliferation, differentiation, apoptosis and adhesion mechanisms. Rap1 (Ras-proximate-1) regulates apoptosis through interaction with two MAP3K effectors of the MEK/ERK MAP-kinase pathway.

Amino Acid Sequence (1-184)

MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAM
RDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNL
ARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rap1B was determined by SDS- PAGE and Coomassie Brilliant Blue Staining

References:
1. hrzanowska-Wodnicka, M. et al., J. Clin. Invest. 115: 680-687, 2005.
2. Hoshijima, M. et al., Biochem. Biophys. Res. Commun. 157: 851-860, 1988.
3. Kawata, M. et al., Proc. Nat. Acad. Sci. 87: 8960-8964, 1990.
4. Kawata, M. et al., J. Biol. Chem. 264: 15688-15695, 1989.
5. Lova, P. et al., J. Biol. Chem. 278: 131-138, 2003.
6. Matsui, Y. et al., Biochem. Biophys. Res. Commun. 166: 1010-1016, 1990.
7. Pizon, V. et al., Nucleic Acids Res. 16: 7719-only, 1988.
8. Rehmann, H. et al., Nature 455: 124-127, 2008.
9. Rousseau-Merck, M. F. et al., Cytogenet. Cell Genet. 53: 2-4, 1990.
10. Schwamborn, J. C. et al., Nature Neurosci. 7: 923-929, 2004.

Reference citations

No data available

Product Targets

Product Categories

Rap1B Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us