Rab5(Q79L) Protein

10117

Size：25 μl Price：$ 239 Brand：NewEast Place of Origin：USA Immunogen：

Add to cart

Download

Datasheet

MSDS

Product Description Reference citations(0) Related Products

Rab5(Q79L) Protein

Cat. #: 10117

Product Name: Rab5 Protein Q79L mutant

Synonyms: Member RAS oncogene family, RAB5A

Source: Human, recombinant full length, His6-tag

Expression Host Species: E. coli

Molecular Weight: 17 kDa

Purity: >96% by SDS-PAGE

Introduction: Rab5, consists of three isoforms, Rab5A, Rab5B, and Rab5C, is a small GTPase that is localized to early endosomes. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes.

Amino Acid Sequence (16-184, Q79L)

NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERY
HSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQ
SYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKN

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab5 Q79L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.

References:
1. Bucci, C. et al., Cell 70: 715-728, 1992.
2. Kinchen, J. M. et al., Nature 464: 778-782, 2010.
3. Kitano, M. et al., Nature 453: 241-245, 2008.
4. Lanzetti, L. et al., Nature 429: 309-314, 2004.
5. Lanzetti, L. et al., Nature 408: 374-377, 2000.
6. Miaczynska, M. et al., Cell 116: 445-456, 2004.
7. Ohya, T. et al., Nature 459: 1091-1097, 2009.
8. Otomo, A. et al., Hum. Molec. Genet. 12: 1671-1687, 2003.
9. Rousseau-Merck, M. F. et al., Hum. Genet. 86: 350-354, 1991.
10. Stenmark, H. et al., Cell 83: 423-432, 1995.
11. Xiao, G.-H. et al., J. Biol. Chem. 272: 6097-6100, 1997.
12. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989.

Reference citations

No data available

Product Targets

Product Categories

Rab5(Q79L) Protein

RhoA Protein

Fascin1 Protein

RalB Protein

Rab7 Protein

Contant Us